PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_559DD9894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 734aa    MW: 83857.3 Da    PI: 7.2635
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_559DD9894.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR168.71.4e-2141127290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                             Y++Y++++GFsvrk k+++   ++ i +++++Cskeg + +e  +  +++ +r+ trt+Cka+++ + +++g+w v++++  HnH+l
  Traes_7DS_559DD9894.1  41 LYCDYGHRIGFSVRKGKQSYFIGTRDIRTKDYYCSKEGLKYDEPVT--EANFNRPDTRTNCKAMVRFRVDEKGRWTVIRFVPLHNHQL 126
                            7********************9999****************99988..9999***********************************9 PP

                   FAR1  90 a 90 
                            a
  Traes_7DS_559DD9894.1 127 A 127
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-1941127IPR004330FAR1 DNA binding domain
PfamPF105517.5E-32249342IPR018289MULE transposase domain
PROSITE profilePS509669.038530566IPR007527Zinc finger, SWIM-type
PfamPF044343.5E-6531563IPR007527Zinc finger, SWIM-type
SMARTSM005752.1E-5541568IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 734 aa     Download sequence    Send to blast
MRKNGEAGKK GEDHGNALSR KEATEELIGC MVHSEEEAYK LYCDYGHRIG FSVRKGKQSY  60
FIGTRDIRTK DYYCSKEGLK YDEPVTEANF NRPDTRTNCK AMVRFRVDEK GRWTVIRFVP  120
LHNHQLAKPG ERHLLRSAKS FAVGKSGVID PAESAESHAM NGSSDRTVGD ISEPPGYTTR  180
DCYNHDNVQN ITLIGAGDSQ SLVSYFKRRT NEEGMFYWDV QVDQEGRMTN FFFRDGKSRS  240
DYDCFGDAVI FDTTYRTNKY SLICAPFVGV NHHWHNVVFG FAFLLDDSTA SYVWLFKSFL  300
ESMGGRSPKS IFTDQDEAIM QAAEQVFPNT RHCFSYWHIL KNAQSHLGTV NTSQAFQNMF  360
MKCMQGCDTE MELQESWDAM LDEYKLQDND WLNGLYKFHN RWCSVFNKDT FDGGINSSQW  420
GEVSNNILTG VADESTSITR FALLLEKVVK TLRRNESEED FRCSQTAPVR AIKHSTVLKQ  480
AAESYTHRMY KLFEAEFLDG CGATSCHENS CGGSLLRFEI TMQGRGSKMW TVLLDTSTME  540
ISCGCGKFER MGLLCSHALK AFSLQNVDMV PEKYILKRWT KDARRSMYNL SQEDSTQQEC  600
TEAELAYRNR AMQYAYNLAL KSQELEEARK IFWDSLETGE KALEVFFEMR NLHAQSAKDA  660
STREKKKKKK IPKGPKKAKQ ALASSSAAPV LTAQTNEQQF QSAQDANGNA TIGRSYYYQV  720
HINMYEMLSF LLAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1665676KKKKKIPKGPKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3711050.0AK371105.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2125C10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561049.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 9-like
TrEMBLW5I7C50.0W5I7C5_WHEAT; Uncharacterized protein
STRINGMLOC_13034.80.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-98FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]